Carrier profile · USDOT 3132454 · MC-93887 · FMCSA profile data as of Aug 16, 2026

Daryl Martin Freight Service LLC

1 power unitOLATHE, KS50/100

CARRIER INACTIVEMC-93887 INACTIVE

Observed fleet · trailing 24 mo daily

1Power units

Self-reported · MCS-150

—Trailers seen

None observed · 24 mo

—Avg age (yr)

Not yet decoded

Call dispatch(816) 205-7996 Email dispatchdarylmartinfreightservice@gm.

Click to see how we scored it

Load decision · FMCSA profile data as of Aug 16, 2026

Limited record

Not enough federal record to assess. Verify authority and insurance directly.

Watch · 4

USDOT registration inactiveThe USDOT record is flagged inactive — the carrier may not be authorized to operate.No active operating authorityNo active common, contract, or broker authority is on file for a for-hire carrier.No inspection history despite active fleetAn established carrier reporting 1 power units has no roadside inspections — a common shell/paper-carrier signal.MCS-150 census data outdatedThe biennial MCS-150 update is 7.7 years old; fleet/mileage figures may be unreliable.

In good standing · 1

Established 8 yearsOperating authority has been on file since 2018.

USDOT registration

yr registered

No active authority

Insurance (BIPD)— unknown

No filing on record

Vehicle OOS · 24-mo—

No inspections · 24 mo

Crashes · fatal—

No crash record

USDOT registration

yr registered

No active authority

Insurance (BIPD)— unknown

No filing on record

Vehicle OOS · 24-mo—

No inspections · 24 mo

Crashes · fatal—

No crash record

Vektor intelligence · beyond the federal recordProprietary signals computed from VIN-decoded inspections & daily FMCSA snapshots

Fleet typeIdentity

Owner-operator

1 power unit. Brokers price each fleet type apart.

Fleet age vs peersDecoding

—

Not yet decoded

Identity stabilityStable

8 yr unchanged

Same registration since 2018 — no chameleon / reincarnation signal.

Safety

Roadside inspections, BASICs & crash history

FMCSA safety data as of Sep 3, 2026

Out-of-service rate· 24-mo cumulative

No roadside inspections on record.

Roadside inspection history· 24 charted calendar months · vehicle / driver level · any-OOS overlay

No roadside inspections on the FMCSA record in this window

Explore full safety record — inspections, BASICs, crashes

Authority & Insurance

Can they legally + adequately haul your load?

FMCSA authority & insurance data as of Aug 16, 2026

Operating authority· 49 CFR · per type

Operating authority

Common: Inactive
Contract: None
Broker: None

Insurance & bonds

BIPD filing (census)Not recorded per census

Cargo filing (census)Not recorded per census

Surety bond (census)Not recorded per census

Insurance continuity· insurer · policy · lapses

$750K BIPD last filed ’19 · 1 insurer · 0 lapsesContinuous

Great West’18–’19

beyond this history

2018202020222024now

Shorter eras are too brief to label at this scale — all 1 insurers are named in the list below.

This timeline is the FMCSA filing history, and it ends at the most recent superseded filing — current policy status is not tracked here. Request a certificate of insurance to confirm active coverage before tendering.

All 1 insurer era · dates, limits, renewals

Insurer	Period	Limit	Renewals
GREAT WEST CASUALTY CO.	Jun 2018 → May 2019	$750K	1

Explore full authority & insurance record

Equipment

VIN-decoded · NHTSA vPIC

FMCSA equipment data as of Sep 10, 2026

Capacity· power units = haulable capacity; trailers are towed

Registered power units (MCS-150): 1
Observed power (24 mo): —
Trailers (towed): —

Capacity is power units only — trailers are towed equipment and are never summed into a fleet-size figure.

Explore full fleet — VIN roster, equipment mix, age distribution

Operations & Lanes

Revealed by inspection density · 24 mo

FMCSA operations & lanes data as of Sep 17, 2026

Inspection density by state· each tile = a state · shade = inspections, last 24 mo

Home base

OLATHE, KS

15606 W 146TH TERR

Density

fewermore

Shade = roadside inspections, last 24 mo.

See the full operating map — state density, top lanes

Network & Fraud

Affiliated entities & reincarnation signals · for review, not a verdict

FMCSA network & fraud data as of Sep 3, 2026

Shares a registration email domain with other carriers

@gm. — 73 carriers: USDOT 1952958 USDOT 2491696 USDOT 2556188 USDOT 2562281 USDOT 2567319 USDOT 2569403 USDOT 2570204 USDOT 2578527

Shares a company officer with other carriers

daryl martin — 5 carriers: USDOT 613869 USDOT 1350004 USDOT 2931502 USDOT 4221400

Explore the carrier network & VIN cross-links

Identity & Federal

FMCSA census + L&I dossier

FMCSA identity & federal data as of Sep 3, 2026

Location

Physical address: 15606 W 146TH TERR, OLATHE, KS, 66062
Mailing address: 119 N PARKER ST STE 301, OLATHE, KS, 66061-3139
Operation: Interstate

Contact

Phone: (816) 205-7996
Fax: (913) 543-5438
Email: darylmartinfreightservice@gm.
Web domain: gm.

Registration

Officer: Daryl Martin
USDOT / docket: 3132454 · MC-93887
First registered: May 4, 2018
Last MCS-150: Jan 19, 2019 · 0 mi
FMCSA safety rating: Not rated
Recordable crash rate: 0.00
D-U-N-S: —

Fleet (self-reported · MCS-150)

Power units

Drivers

CDL drivers

—Annual mileage

Open the full identity & federal record

Federal activity

Daily-captured FMCSA licensing & insurance changes — monitored by Vektor

FMCSA federal activity data as of Sep 3, 2026

Federal record activity· monitored daily by Vektor

No licensing or insurance changes captured since Vektor began monitoring this carrier (June 2026). Quiet is usually good.

Open the full federal-record activity feed

Reviews

Verified broker, shipper & driver reviews — moderated

Performance ratings only — never the Vektor risk score

No verified reviews yet

Be the first broker or shipper to rate DARYL MARTIN FREIGHT SERVICE LLC. Reviews cover performance only — on-time delivery, payment speed, communication — and never affect the Vektor risk score.

Leave a review

Open reviews

Verification summaryAuthority, insurance, safety and identity facts for DARYL MARTIN FREIGHT SERVICE LLC.

DARYL MARTIN FREIGHT SERVICE LLC (USDOT 3132454) is unrated by Vektor because the carrier's FMCSA record does not contain enough evidence for a safety score. FMCSA profile data as of Aug 16, 2026.

The carrier has no active for-hire operating authority per FMCSA L&I. FMCSA authority data as of Sep 3, 2026.

It has an unknown current BIPD insurance status because no FMCSA L&I active-filing snapshot is available. FMCSA insurance data as of Aug 16, 2026.

The carrier received 0 roadside inspections in the last 24 months — 0 vehicle-level and 0 driver-level, according to FMCSA roadside-inspection data. FMCSA operations data as of Sep 17, 2026.

It reports 1 power unit and 1 driver in its most recent MCS-150 filing dated Jan 19, 2019. FMCSA identity data as of Sep 3, 2026.

It has no FMCSA-assigned safety rating in the federal record. FMCSA identity data as of Sep 3, 2026.

Frequently asked

What is DARYL MARTIN FREIGHT SERVICE LLC's USDOT number?

DARYL MARTIN FREIGHT SERVICE LLC's USDOT number is 3132454, and its motor carrier number is MC-93887.

Is DARYL MARTIN FREIGHT SERVICE LLC authorized to operate?

FMCSA authority data as of Sep 3, 2026. DARYL MARTIN FREIGHT SERVICE LLC is inactive in the FMCSA register with common, contract, broker operating authority on file.